DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and LOC100909955

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_038936344.1 Gene:LOC100909955 / 100909955 RGDID:6501070 Length:187 Species:Rattus norvegicus


Alignment Length:174 Identity:72/174 - (41%)
Similarity:96/174 - (55%) Gaps:8/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHK 73
            |.:..||.||.:|:...|..|.:..||..|.||||||||.||.|||.|.|       ||.:.||:
  Rat    21 AAELVNPTVYFNITADGEPLGHVSFELFADNVPKTAENFHALSTGEKGFG-------YKASSFHR 78

  Fly    74 IKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGC 138
            |...|:.|.|:|..::|:.|.|||...|:.|:..|.|...|::|||| .:||::.|||||..|..
  Rat    79 IIPGFMCQGGNVTCHNGAGGRSIYREKFEGEDVILKHTGPGILSMAN-DEPNTSGSQFFICTAKT 142

  Fly   139 ENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGE 182
            |.|.|..||..:...|:.||..||:..:..|..:..|.|..||:
  Rat   143 EWLGGKGVVFEKAKDGMNIVEAMERFGSRNGKTSKQITISGCGQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 68/165 (41%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
LOC100909955XP_038936344.1 cyclophilin 27..185 CDD:412213 68/165 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.