DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and LOC100496569

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_002932593.1 Gene:LOC100496569 / 100496569 -ID:- Length:170 Species:Xenopus tropicalis


Alignment Length:168 Identity:85/168 - (50%)
Similarity:106/168 - (63%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVF 78
            |..|:.|||......||:::|||.||||||||||..|||||||.|       |||..||:|...|
 Frog     3 NKRVFFDISANDIPLGRIVMELRFDVVPKTAENFLKLCTGECGFG-------YKGCTFHRIIPSF 60

  Fly    79 VVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            :.|.||...::|:.|:||||..|:||||.|.|:..||:||||.| ||.|.||||||....|.|||
 Frog    61 MCQGGDFTNHNGTGGKSIYGGKFEDENFNLKHSTPGVLSMANAG-PNCNGSQFFISTIKAEWLNG 124

  Fly   144 TNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCG 181
            .:||.|.|:.|:.:|.:||....:.|..:..|:|.|||
 Frog   125 KHVVFGHVVEGMEVVKKMESYGCNSGKTSKKILISDCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 82/165 (50%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
LOC100496569XP_002932593.1 cyclophilin_ABH_like 5..162 CDD:238907 82/164 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.