DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Nktr

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:311 Identity:99/311 - (31%)
Similarity:155/311 - (49%) Gaps:57/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHKIKRVF 78
            |..:.||.|.:|..||::.:|..|:.|||.:||..||:||.|:| |.||.|.|||:.||::.:.|
  Rat    66 PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNF 130

  Fly    79 VVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            ::|.||..:.:|..||||||..|.||||.|.|:...::||||.|| ::|.|||||:.....:|:|
  Rat   131 MIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGK-HTNGSQFFITTKPAPHLDG 194

  Fly   144 TNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIA----------------HNEDWGI 191
            .:||.|.|:.|..::.::|...||... |.|.:.:.|||.:|                |:||...
  Rat   195 VHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKLTKDVFEKKRKKPTHSEDSDS 259

  Fly   192 ECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKYRKANRYYHY 256
            ..|..::              .:.:.:..|| ...||:         |.|:.|.|.|...:....
  Rat   260 SSNSSSS--------------SESSSESEVE-RERIRR---------RRHKRRPKVRHTKKRRKE 300

  Fly   257 LSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVGNYTSARE 307
            :|   |.::|.  :|..|..     :|:|..:::|    :.:.|:..:.||
  Rat   301 MS---GSEELR--RKRTVSP-----EGYSERSDVN----EKRSGDSNTKRE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 72/167 (43%)
TPR repeat 285..315 CDD:276809 5/23 (22%)
TPR_19 300..369 CDD:291240 3/8 (38%)
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 72/167 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.