DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and nktr

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_002939352.1 Gene:nktr / 100145676 XenbaseID:XB-GENE-992970 Length:1394 Species:Xenopus tropicalis


Alignment Length:262 Identity:91/262 - (34%)
Similarity:132/262 - (50%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTL-GKPLHYKGTKFHKI 74
            :...|..|.|:.|.:|..||::.:|..||.|||..||..|||||.|||.: ||.|.|||:.||::
 Frog     3 EKARPQCYFDVEINREPVGRIVFQLFSDVCPKTCMNFLCLCTGEKGIGKVTGKKLCYKGSTFHRV 67

  Fly    75 KRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCE 139
            .:.|::|.||..:.:|..||||||..|.||||.|.|:...::||||.|| |:|.|||||:.....
 Frog    68 VKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGK-NTNGSQFFITTKAAP 131

  Fly   140 NLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI--------------AHNEDW 189
            :|:|.:||.|.|:.|..::.::|...||... |.|.:.:.|||.:              :.:||.
 Frog   132 HLDGVHVVFGLVISGFEVIEQIESLKTDAASRPYADVRVIDCGLLVSKAAREEKIKRAASQSEDS 196

  Fly   190 GIECNDETTDKLPAYPQDWPRKLDKFTGDGAVEL----------LTGIRQSGNHFYQLGRYHEAR 244
            .......|    |:.|..   ..:..:.:...|:          .|.::.|.....:.||..|||
 Frog   197 DSSLKSTT----PSSPSS---SSESTSSESEAEIERHRRKKRKRKTKVKHSKRRRKESGRKEEAR 254

  Fly   245 AK 246
            .|
 Frog   255 EK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 75/167 (45%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
nktrXP_002939352.1 cyclophilin 7..174 CDD:381853 75/167 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.