DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67b and Or49a

DIOPT Version :9

Sequence 1:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:110/294 - (37%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MFFFKIVCM---PVLYYCVRPYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFP-----SY 209
            :::|.:|.|   |::..|:    .|:......|       .||..|.|.....:.|.|     :|
  Fly   138 VYYFVMVVMALEPLVQSCI----MYLIGFGKAD-------FTYKRIFPTRLTFDSEKPLGYVLAY 191

  Fly   210 VIRFFLLQ-------SGPLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQRV 267
            ||.|...|       ...||    :...:|...:...|.:.::..:|...:....|        .
  Fly   192 VIDFTYSQFIVNVSLGTDLW----MMCVSSQISMHLGYLANMLASIRPSPETEQQD--------C 244

  Fly   268 KYLQCCVR---LFARISSHHNQI------ENLFKYIILVQCSVSSILICMLLYKISTVLEVGWVW 323
            .:|...::   |..|:....|.:      .|||        :.|.:|.||..|   ||:| |:.|
  Fly   245 DFLASIIKRHQLMIRLQKDVNYVFGLLLASNLF--------TTSCLLCCMAYY---TVVE-GFNW 297

  Fly   324 MGM-IMVYFVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFV 387
            .|: .|:.|.::|.:..:.:...|.:...|..|....:...||..|..:|..|.:::..::|...
  Fly   298 EGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLE 362

  Fly   388 LSVGGFTSLSHKFLVQVFRLSANFFLLLRNMNNK 421
            :|..|...:|......:..::..||.::|....|
  Fly   363 ISARGVIIISLDTFKILMTITYRFFAVIRQTVEK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 47/232 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 57/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.