DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67b and Or45b

DIOPT Version :10

Sequence 1:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:121 Identity:28/121 - (23%)
Similarity:40/121 - (33%) Gaps:36/121 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTRGLLM-VFGYAYPAYECFKTVELNKPEIQQ---------------LQFWCQYWIIVAALT--- 51
            |.||.:. :||.::.|.: |.|.|..|.:..|               |.|.....:|.||.|   
  Fly   197 LYRGFVPGMFGVSHGALQ-FMTYEEMKNKYNQHRKRPIDAKLTTSEYLTFAAVSKLIAAAGTYPY 260

  Fly    52 --IFERIGDALVSWLPMYSEAKLAFFIYLW--------------FPKTKGTTYVYD 91
              |..|:.|...|:...:...||.:....|              .|.|..|...|:
  Fly   261 QVIRARLQDQNHSYKGTWDCVKLTWRFESWRGFYKGLGPNLTRVIPATMVTFVTYE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 28/121 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.