DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and PAB3

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_173690.1 Gene:PAB3 / 838882 AraportID:AT1G22760 Length:660 Species:Arabidopsis thaliana


Alignment Length:339 Identity:72/339 - (21%)
Similarity:140/339 - (41%) Gaps:67/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LSKEDD---ISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMP 415
            ||..|.   :|..|.||.:||..:...:.|.:.|..||.::...:.:| :|.:.||:|.|.:...
plant   123 LSNRDPSTRLSGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMD-VTGRSKGYGFVQFEKE 186

  Fly   416 EHALKAFNTLDGTDFHGRLLHLLPSKDI-----EKNPKEDLDENDASLSFKEKKALKLKKNAQKP 475
            |.|..|.:.|:|.        |:..|.:     .:..:...|||..:..|.....    ||..|.
plant   187 ESAQAAIDKLNGM--------LMNDKQVFVGHFIRRQERARDENTPTPRFTNVYV----KNLPKE 239

  Fly   476 IGWNTL---FLGANAVAEILAKQFKTSKERI-----LDTSDGGSSAAVR---LALGETQVVI--- 526
            ||.:.|   |.....::..:..:.::...|.     .:.::..:||..:   ::||:..:.:   
plant   240 IGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMNGISLGDDVLYVGRA 304

  Fly   527 --------EMKRFLEEEGVRLDAFDEPAKKRSNTVILAKNLPAATEISEITPIFSRFGPI--GRI 581
                    |::|..|:|  |::.|:    |.....:..|||..:.:..::..:||.:|.:  .::
plant   305 QKKSEREEELRRKFEQE--RINRFE----KSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKV 363

  Fly   582 VLPPSGVT---ALIEYCDPLEARQAFKKLAYSKFKNAPLYLEWAP---------EQVFTKTLSGE 634
            :|.|.|::   ..:.|.:|.||.:|..::........|||:..|.         :.:|::..:..
plant   364 MLNPQGMSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQRKEDRRAHLQALFSQIRAPG 428

  Fly   635 PVI----PKSEPKP 644
            |:.    |...|.|
plant   429 PMSGFHHPPGGPMP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 21/77 (27%)
RRM4_RBM19 552..623 CDD:241013 17/75 (23%)
RRM <638..845 CDD:223796 3/7 (43%)
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
PAB3NP_173690.1 PABP-1234 49..644 CDD:130689 72/339 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.