DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and AT4G20030

DIOPT Version :10

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:88 Identity:27/88 - (30%)
Similarity:50/88 - (56%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 SGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDG 427
            :.:|..|||.::|:|:.|::.|..||.:.||.|..|:..::.||:..:.:...:.|..|..|:|.
plant    39 ASKIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDR 103

  Fly   428 TDFHGRLLHLLPSKDIEKNPKED 450
            ..::||::::    ||.|..|.|
plant   104 RMYNGRMIYI----DIAKPGKRD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689 22/71 (31%)
RRM3_RBM19 362..440 CDD:409983 22/76 (29%)
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768
RRM5_RBM19_like 679..760 CDD:409757
RRM6_RBM19 785..864 CDD:409985
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.