DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and CG34354

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:72/177 - (40%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   716 PENPREFKSLGY--------GFIQFKKSSVAEHALKNLQLTHIDGNPVELKRSDRVLKTQDNDGA 772
            |..|.|.|.|..        ...|.::|..|.|...|.|..|      ..::..:.:..|.....
  Fly    25 PHKPPETKLLAIHPAAAAAAAAQQQQQSVTAAHLQHNGQQQH------SQQQQQQQMSQQQQQQQ 83

  Fly   773 QRRLASQKKQTGTKILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMS 837
            |:.:.:..|.....|.|.::..:.:.::::|.|..|||:...|:.:...|.:.  :|:|||.::.
  Fly    84 QQLVGNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRDPQTLKS--KGYGFVSFVK 146

  Fly   838 KAEAKRAFDALSASTHLYGRRLVLEWSANDDNQDVEELRKRTAAKFD 884
            |:||:.|..|::.. .|..|.:...|:.          ||..|.|.|
  Fly   147 KSEAETAITAMNGQ-WLGSRSIRTNWAT----------RKPPATKAD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 31/136 (23%)
RRM5_RBM19_like 679..760 CDD:240764 12/51 (24%)
RRM6_RBM19 785..864 CDD:241015 20/78 (26%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 20/76 (26%)
RRM3_TIA1_like 202..278 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.