DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Ref1

DIOPT Version :10

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:129 Identity:33/129 - (25%)
Similarity:48/129 - (37%) Gaps:24/129 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 ASKSGQPLAPAAVDAG--------------------NAKWKHQQDSLSKEDDI---SESGRIFFR 369
            |:..|.|..|.:|..|                    |:.|||......|...:   |...|:...
  Fly    50 ANAGGSPRKPGSVLKGPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVG 114

  Fly   370 NLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDFHGR 433
            ||.|..:..|:::||..|||:.:..:..|:..|.: |...|.:.....||||.....|....||
  Fly   115 NLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSL-GTADVIFERRADALKAIKQYHGVPLDGR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689 33/129 (26%)
RRM3_RBM19 362..440 CDD:409983 21/72 (29%)
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768
RRM5_RBM19_like 679..760 CDD:409757
RRM6_RBM19 785..864 CDD:409985
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 33/129 (26%)
RRM_THOC4 109..183 CDD:410081 21/70 (30%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.