DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Rb97D

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:284 Identity:61/284 - (21%)
Similarity:114/284 - (40%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 IVNDAKPDEEDS-------RAEDADDEPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAK 712
            :|.|....:|.:       |.||...|.|....||:..|...|.:|.::..:...|.:  |::..
  Fly     1 MVKDEPLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKV--VDVVV 63

  Fly   713 RRDPENPREFKSLGYGFIQFKKSSVAEHALKNLQLTH-IDGNPVELKRSDRVLKTQDNDGAQRRL 776
            .||....|   |.|:|||.:.||.:.:.|.:|  ..| |||..||.||:   |...:.:..:..:
  Fly    64 MRDAATKR---SRGFGFITYTKSLMVDRAQEN--RPHIIDGKTVEAKRA---LPRPERESRETNI 120

  Fly   777 ASQKKQTGTKILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMSKAEA 841
            :.:      |:.|..:........:|:.|..||.:.|:::....|||:  .|||.||::      
  Fly   121 SVK------KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGK--RRGFAFVEF------ 171

  Fly   842 KRAFDALSASTHLYGRRLVLEWSANDDNQDVEE--LRKRTAAKFDGSQAATAAKRSRKSFFDVE- 903
                                     ||...|::  |:|:.|.|:.....       :||.:::: 
  Fly   172 -------------------------DDYDAVDKAILKKQHAIKYVHVDV-------KKSIYNLDK 204

  Fly   904 ----------GSVQPNQDDDEEEE 917
                      .:::|:.:..::::
  Fly   205 KEKQQPGGLANAIKPSLNQQQQQQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 51/197 (26%)
RRM5_RBM19_like 679..760 CDD:240764 26/81 (32%)
RRM6_RBM19 785..864 CDD:241015 15/78 (19%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 28/86 (33%)
RRM2_hnRNPA_like 124..196 CDD:240774 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.