DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Rox8

DIOPT Version :10

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:92 Identity:23/92 - (25%)
Similarity:43/92 - (46%) Gaps:15/92 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YVYDSFFRPYIAKHENEIDRNLVKVKTRAKDMAMIYLQKAINQGQTKFFEI--LQYITEQSTPKS 150
            |:::|..:    |...|:..||.|::|       :||.|...:..::|..:  |.|:...|....
  Fly   190 YMHNSDMK----KLPKELVSNLPKLET-------LYLDKNKLKHVSQFTTLPNLMYLNISSNQLV 243

  Fly   151 KAEEKKETTIPKLDDPILKVKENEVTK 177
            |.:|...:.:|||  .||.:..|::.:
  Fly   244 KLQENVFSRLPKL--KILDLSSNKLKR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689
RRM3_RBM19 362..440 CDD:409983
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768
RRM5_RBM19_like 679..760 CDD:409757
RRM6_RBM19 785..864 CDD:409985
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789
RRM_SF 221..292 CDD:473069 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.