DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and CG5213

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:234 Identity:55/234 - (23%)
Similarity:91/234 - (38%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 DEPEP------NTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQ 731
            |.|.|      .|.|.|..|.....:..:.:.|...|.|...:|.:.|     |...|..|||:.
  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHR-----RTGISCCYGFVD 88

  Fly   732 FKKSSVAEHALKNLQLTHIDGNPVELKRSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNIPFQA 796
            :.....|..|:..:     ||.....||    ||.     |..| .|:.:.|.:.:.|.|:|...
  Fly    89 YVSERQAAAAVNGM-----DGYETRGKR----LKV-----AFAR-PSEYESTSSSLYVGNLPTYM 138

  Fly   797 QYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMSKAEAKRAFDALSASTHLYGR-RLV 860
            ..::||::|..:|.:..:.:.:.......  ||..|:.:....:|:.|         .||. |.:
  Fly   139 DEKKVRELFATYGNIVDVNLLRHKFNNRS--RGVAFLQFELVRDAEVA---------KYGMDRYM 192

  Fly   861 LEWSAND-DNQDVEELRKRTAAKFDGSQAATAAKRSRKS 898
            :|.::.. ..:.||..:|.:::...|||    .|..|||
  Fly   193 IEGASRPLTVKFVEREKKGSSSTSSGSQ----YKDKRKS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 40/177 (23%)
RRM5_RBM19_like 679..760 CDD:240764 19/80 (24%)
RRM6_RBM19 785..864 CDD:241015 16/79 (20%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/94 (24%)
RRM 128..202 CDD:214636 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.