DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Rbp1

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:141 Identity:31/141 - (21%)
Similarity:56/141 - (39%) Gaps:35/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 KILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMSKAEAKRAFDALSA 850
            |:.|.|:...|...|:...|..:|.||::.:.:...       ||.||::..:.:|:.|..||. 
  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPP-------GFAFVEFEDRRDAEDATRALD- 68

  Fly   851 STHLYGRRLVLEWSANDDNQDVEELRKRTAAKFDG-------------SQAATAAKRSRKSFFDV 902
            .|...|.|:.:|.|:.         |.|...:.:|             :.:|.....:..||:::
  Fly    69 GTRCCGTRIRVEMSSG---------RSRDRRRGEGGSSGRSGSGRYRITPSARTTSTATSSFYNI 124

  Fly   903 -----EGSVQP 908
                 :.|.||
  Fly   125 NNLQQQPSSQP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 14/58 (24%)
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015 21/77 (27%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.