DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and SLIRP2

DIOPT Version :10

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:79 Identity:21/79 - (26%)
Similarity:37/79 - (46%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 ISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNT 424
            :..|.::|..||.:|...::||..|.::|.|....:..|:.....|.:|.|.:...:    |||:
  Fly     6 VRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRD----AFNS 66

  Fly   425 LDGTDFH---GRLL 435
            ....:.|   ||:|
  Fly    67 ASNQNTHFLDGRVL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689 20/77 (26%)
RRM3_RBM19 362..440 CDD:409983 21/77 (27%)
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768
RRM5_RBM19_like 679..760 CDD:409757
RRM6_RBM19 785..864 CDD:409985
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.