DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and CG2931

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:64/167 - (38%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 DFTEKNKVTKASKSG-QPLAPAAVD--------------------------AGNAKWKHQQDSLS 355
            |.|:|.|..||.||| .|:|..|:.                          ||...|:....:..
  Fly   129 DVTQKLKKLKAEKSGPNPIAEEAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADW 193

  Fly   356 KEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALK 420
            .:||.    |||..:|.....:|.|.:.|.:|.......:..||.|.|.||||.|::..|...::
  Fly   194 PDDDF----RIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIR 254

  Fly   421 AFNTLDG------------TDFHGRLLHLLPSKDIEK 445
            |...:||            :.:..|.|.::..|:.||
  Fly   255 AMKEMDGRYVGSRPIKLRKSTWRQRSLDVVKKKEREK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 23/89 (26%)
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 23/85 (27%)
RRM <194..>280 CDD:223796 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.