DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and lark

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:79/231 - (34%) Gaps:79/231 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 LFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSVAEHALKNL 745
            ||:.||:.||....:...|...|::...::.|             .|||:..:.......|::||
  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVK-------------NYGFVHMETEQQGRDAIQNL 60

  Fly   746 QLTHID--GNPVELKRSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNIPFQAQYREVRDIFKAF 808
            ....::  ...||..:|.|...|..                |||.|.|:..:.:..|||::|:.:
  Fly    61 NGYTLNEFAIKVEAAKSRRAPNTPT----------------TKIFVGNLTDKTRAPEVRELFQKY 109

  Fly   809 GELRSLRIPKKATTGE-DAHRGFGFVDYMSKAEAKRAFDALSASTHLYGRRLVLEWSANDDNQD- 871
            |           |..| |..|.:|||                   ||         ....|.|| 
  Fly   110 G-----------TVVECDIVRNYGFV-------------------HL---------DCVGDVQDA 135

  Fly   872 VEELRKRTAAKFDGS----QAATAAKRSRKSFFDVE 903
            ::||..|..   ||.    |.:|:..|.:....|.|
  Fly   136 IKELNGRVV---DGQPLKVQVSTSRVRPKPGMGDPE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 37/166 (22%)
RRM5_RBM19_like 679..760 CDD:240764 17/80 (21%)
RRM6_RBM19 785..864 CDD:241015 19/79 (24%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 15/76 (20%)
RRM1_2_CoAA_like 87..152 CDD:409779 26/106 (25%)
hnRNP-R-Q <88..>258 CDD:273732 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.