DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and SLIRP1

DIOPT Version :10

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:79 Identity:27/79 - (34%)
Similarity:41/79 - (51%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTD 429
            |||..||.:|...::||..|.:||.||..|:..||.|...||:|.|::    ::|.|...::...
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF----NSLTALEKIENEQ 76

  Fly   430 FH---GRLLHLLPS 440
            .|   |..|::..|
  Fly    77 KHILEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689 25/72 (35%)
RRM3_RBM19 362..440 CDD:409983 26/77 (34%)
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768
RRM5_RBM19_like 679..760 CDD:409757
RRM6_RBM19 785..864 CDD:409985
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.