DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Caper

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:432 Identity:92/432 - (21%)
Similarity:161/432 - (37%) Gaps:114/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GSEDKPQSWSKY----AKDSKKNLDKLKEKEREAAAKAKESEKKKKKDKVDKVDQILSRHKDDPE 141
            ||..|.||....    ::|.|...|:..|:   ::.:.|:.|:.:.:|..|:     .||:.:  
  Fly    59 GSSHKKQSKRSRSRSGSRDGKSRRDRGNER---SSHRDKDKERDRNRDGGDR-----DRHRRE-- 113

  Fly   142 FQEFLEAHDKSRTLWGNDLGINKNRENEEEDDEEQEESRAARDDSGVDADAGDED---------G 197
                               |.:::||.|.|.:.::.....:||:.|.....||.|         |
  Fly   114 -------------------GGDRDRERERERERDRSRRSRSRDERGGGGRYGDRDKDRRSRDRRG 159

  Fly   198 SGDEADEEEDTDK--------LAEKPISDLEYMKSLMATT---------SGEATAKKPKAKADKS 245
            .......:...||        ...|.:|.:...|...:.:         :.....:.|...||::
  Fly   160 GSKSLQVDRSRDKRRRSRSRDQQRKRLSPIRERKRSHSRSRDRNSRRRGTNSPRRRSPPNGADRT 224

  Fly   246 N-LEL----------FTIKIHNVPYNTKRQEVLKFFKPL-KPYSVRL-----PSKVHGFCYVGFK 293
            . .||          |.|::..   ..:.:::.:||..: |...|||     ..:..|..|:.|.
  Fly   225 TPTELSPEERDARTVFCIQLSQ---RVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFD 286

  Fly   294 TEKDMAKGMLKNKSFIKGKQVFFSDF-TEKNKVTKASKSGQPLAPAAVDAGNAKWKHQQDSLSKE 357
            ..:.:|..:..:...:.|..:..... .|||::..|:.:.||.                      
  Fly   287 DPESVALALGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPK---------------------- 329

  Fly   358 DDISESG--RIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALK 420
               |.:|  |::..:|.:..||:.||.:||.||.:..:.|.:|..|.:.||:|.:||...:.|.|
  Fly   330 ---SHTGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKK 391

  Fly   421 AFNTLDGTDFHGRLLHLLPSKDIEKNPKEDLDENDASLSFKE 462
            |...|:|.:..|||:.:       .|..|.||.|..||...|
  Fly   392 ALEQLNGFELAGRLMKV-------GNVTERLDMNTTSLDTDE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621 13/69 (19%)
RRM3_RBM19 362..440 CDD:241011 27/79 (34%)
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 13/74 (18%)
RRM2_RBM23_RBM39 337..409 CDD:240730 25/78 (32%)
RBM39linker 425..500 CDD:292157 1/2 (50%)
RRM3_RBM39_like 483..567 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.