DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and Hrb27C

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:93/228 - (40%) Gaps:56/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 EEDSRAEDADDEPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGY 727
            |||.|.:           ||:..|:::|.||.:.::|...|.|....:.|     |....:|.|:
  Fly     2 EEDERGK-----------LFVGGLSWETTQENLSRYFCRFGDIIDCVVMK-----NNESGRSRGF 50

  Fly   728 GFIQFKKSSVAEHALKNLQLTHIDGNPVELKRSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNI 792
            ||:.|...:...|.|:|...| :||..::.|..:           .|.|...||..|.|:.:..:
  Fly    51 GFVTFADPTNVNHVLQNGPHT-LDGRTIDPKPCN-----------PRTLQKPKKGGGYKVFLGGL 103

  Fly   793 PFQAQYREVRDIFKAFGELRSLRI----PKKATTGEDAHRGFGFVDYMSKAEAKRAFDALSASTH 853
            |......::|..|..:|::..:.|    .||.:      |||||:          :|:..|:..|
  Fly   104 PSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKS------RGFGFL----------SFEEESSVEH 152

  Fly   854 LYGRRLVLEWSANDDNQDVEELRKRTAAKFDGS 886
            :...|.:        |.:.:::..:.|...|||
  Fly   153 VTNERYI--------NLNGKQVEIKKAEPRDGS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 45/185 (24%)
RRM5_RBM19_like 679..760 CDD:240764 23/80 (29%)
RRM6_RBM19 785..864 CDD:241015 17/82 (21%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 25/108 (23%)
RRM2_DAZAP1 94..173 CDD:240773 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.