DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3335 and x16

DIOPT Version :9

Sequence 1:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:287 Identity:53/287 - (18%)
Similarity:97/287 - (33%) Gaps:85/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIIVKQLPKHITEDKLRQIFGAQGTITDLQLKYTPDGKFRQFCFVGYSTEEEAQSAIRHFDNTCI 67
            ::.|..|..:..::.|..:|||.|::..:.:...|.|    |.||.:.:..:|..|:|..|...:
  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPG----FAFVEFESARDAADAVRGLDGRTV 69

  Fly    68 QTSRVRVESCAALGSEDKPQSWSKYAKD-----------------------SKKNLDKLKE---- 105
            ...|.|||           .|..|||:.                       ..:..||..|    
  Fly    70 CGRRARVE-----------LSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGR 123

  Fly   106 -------KEREAAAKAKESEKKKKKDKVDKVDQILSRHKDDPEFQEFLEAHDKSRTLWGNDLGIN 163
                   :||:|..:.:.:...:.:.        .||.:     :...::..:||:.....:|..
  Fly   124 GHFARHCRERKARQRRRSNSFSRSRS--------TSRRR-----RTRSKSGTRSRSRSAGSVGRR 175

  Fly   164 KNRENEEEDDEEQEESRAARDDSGVDADAGDEDGSGDEA----------DEEEDTDKLAEKPISD 218
            ..|.|             .||::|..:...|.:.:|..|          .|:||.|::...|.|.
  Fly   176 SGRSN-------------GRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSR 227

  Fly   219 LEYMKSLMATTSGEATAKKPKAKADKS 245
            .....:..|...|....::..:.|.:|
  Fly   228 SRSRSASPAVRRGSPPRRRGDSSASRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008 20/73 (27%)
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
x16NP_723226.1 RRM <1..>82 CDD:223796 21/87 (24%)
RRM_SRSF3_like 9..81 CDD:240819 21/86 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.