DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LanB2 and LCR21

DIOPT Version :9

Sequence 1:	NP_001287009.1	Gene:	LanB2 / 39118	FlyBaseID:	FBgn0267348	Length:	1639	Species:	Drosophila melanogaster
Sequence 2:	NP_001031746.1	Gene:	LCR21 / 3770554	AraportID:	AT4G29283	Length:	82	Species:	Arabidopsis thaliana

Alignment Length:	55	Identity:	20/55 - (36%)
Similarity:	26/55 - (47%)	Gaps:	11/55 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   727 GYRHSPARGGPFMPCIPCDC--------HGHADICDSETGR---CICQHNTHGDN 770
            |.||......|..||:|.||        :|......|:|||   |:|.:|.||:|
plant    27 GKRHCSTIILPESPCVPQDCVEYCFEEYNGGGTCIASKTGRTTNCMCTYNCHGNN 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LanB2	NP_001287009.1	LamNT	61..296	CDD:214532
		EGF_Lam	298..347	CDD:238012
		Laminin_EGF	359..414	CDD:278482
		EGF_Lam	414..458	CDD:214543
		Laminin_EGF	461..511	CDD:278482
		LamB	572..697	CDD:214597
		TNFRSF	<721..848	CDD:304602	20/55 (36%)
		CRD2	724..771	CDD:276900	20/55 (36%)
		EGF_Lam	743..791	CDD:238012	14/39 (36%)
		Laminin_EGF	847..897	CDD:278482
		Laminin_EGF	902..953	CDD:278482
		Laminin_EGF	956..1004	CDD:278482
		Laminin_EGF	1004..1050	CDD:278482
		V_Alix_like	1122..1443	CDD:187408
		Tar	1139..1521	CDD:223910
		BAR	1308..1469	CDD:299863
		vATP-synt_E	1474..>1629	CDD:304907
LCR21	NP_001031746.1	SLR1-BP	22..77	CDD:284695	16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D156553at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010