DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LanB2 and Megf9

DIOPT Version :9

Sequence 1:NP_001287009.1 Gene:LanB2 / 39118 FlyBaseID:FBgn0267348 Length:1639 Species:Drosophila melanogaster
Sequence 2:NP_766282.1 Gene:Megf9 / 230316 MGIID:1918264 Length:600 Species:Mus musculus


Alignment Length:471 Identity:109/471 - (23%)
Similarity:148/471 - (31%) Gaps:225/471 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 CNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDD-GYCVNCACDPVGSR 422
            |||:.:..   .|....|:|  .|.| ||.....|.:|:.|||.||:... |.|:.|.|.|.|:.
Mouse   202 CNCSEVGS---LDVKRCNQT--TGQC-DCHVGYQGLHCDTCKEGFYLNHTVGLCLPCHCSPHGAV 260

  Fly   423 SLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDTETGICF-CKE 486
            |:.|||.|.||||.||||..||:|.:.:|.||..||..|.|::     .:.:||..||.|. |:|
Mouse   261 SILCNSSGNCQCKVGVTGSMCDKCQDGHYGFGKTGCLPCQCNN-----RSDSCDVHTGACLNCQE 320

  Fly   487 NVEGRRCNECKPGFF-NLDKNNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNKFKERWTAADL 550
            |.:|..|.|||.||: :.|...:  |..|.|...||                             
Mouse   321 NSKGEHCEECKEGFYPSPDAAKQ--CHRCPCSAVTS----------------------------- 354

  Fly   551 NQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKLQLVGQVANTGVSDVI 615
                                                                             
Mouse   355 ----------------------------------------------------------------- 354

  Fly   616 LEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSARGFLSILSNLTAIKIRATYS 680
                                                                             
Mouse   355 ----------------------------------------------------------------- 354

  Fly   681 VQGEAILDDVELQTAHRGAAGHPATWIEQC-TCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPC 744
             .|...::..||:..              | .|.:||.||.|..|..||.:|.:      .|..|
Mouse   355 -TGNCTIESGELEPT--------------CDQCKDGYTGQNCNKCENGYYNSDS------ICTQC 398

  Fly   745 DCHGHAD------ICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKR-CPCPNDGAC 801
            :||||.|      ||..|:|.|| |.|||.|..|::|.:|:.        .|.:| |        
Mouse   399 ECHGHVDPIKTPKICKPESGECINCLHNTTGFWCEKCLEGYV--------RDLQRNC-------- 447

  Fly   802 LQINEDTVICTECPKG 817
              |.::.::.|  |:|
Mouse   448 --IKQEVIVPT--PEG 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LanB2NP_001287009.1 LamNT 61..296 CDD:214532
EGF_Lam 298..347 CDD:238012
Laminin_EGF 359..414 CDD:278482 19/55 (35%)
EGF_Lam 414..458 CDD:214543 23/43 (53%)
Laminin_EGF 461..511 CDD:278482 18/51 (35%)
LamB 572..697 CDD:214597 3/124 (2%)
TNFRSF <721..848 CDD:304602 33/105 (31%)
CRD2 724..771 CDD:276900 22/53 (42%)
EGF_Lam 743..791 CDD:238012 21/54 (39%)
Laminin_EGF 847..897 CDD:278482
Laminin_EGF 902..953 CDD:278482
Laminin_EGF 956..1004 CDD:278482
Laminin_EGF 1004..1050 CDD:278482
V_Alix_like 1122..1443 CDD:187408
Tar 1139..1521 CDD:223910
BAR 1308..1469 CDD:299863
vATP-synt_E 1474..>1629 CDD:304907
Megf9NP_766282.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..199
Med25_SD1 39..185 CDD:288132
Pol_alpha_B_N <75..>199 CDD:285602
MSA-2c <129..182 CDD:289042
Laminin_EGF 202..245 CDD:278482 17/48 (35%)
EGF_Lam 251..295 CDD:238012 23/43 (53%)
EGF_Lam 298..345 CDD:238012 18/53 (34%)
EGF_Lam 346..399 CDD:238012 19/232 (8%)
Laminin_EGF 398..442 CDD:278482 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10574
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.