DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LanB2 and Ntn1

DIOPT Version :9

Sequence 1:NP_001287009.1 Gene:LanB2 / 39118 FlyBaseID:FBgn0267348 Length:1639 Species:Drosophila melanogaster
Sequence 2:NP_032770.2 Gene:Ntn1 / 18208 MGIID:105088 Length:604 Species:Mus musculus


Alignment Length:469 Identity:202/469 - (43%)
Similarity:276/469 - (58%) Gaps:43/469 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRSRWSHSGSSTARLLLIGVLFASCSTAILGAQRPPINSAGGHELRGTTFMPALECYDPYGRPQ 65
            |.|:.|....:..|...|:|        |:.|.  |.::...|...:..      .|.|..|.|:
Mouse     1 MMRAVWEALAALAAVACLVG--------AVRGG--PGLSMFAGQAAQPD------PCSDENGHPR 49

  Fly    66 KCLPEFINAAYQLQIESTNTCGEQNDNHFCI--QTMNQNHKNCEFCKYND----HNPSFLTDLHD 124
            :|:|:|:|||:...:..::||| :....:|:  :...:..::|..|..:|    |.|:|||||::
Mouse    50 RCIPDFVNAAFGKDVRVSSTCG-RPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNN 113

  Fly   125 PQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQ 189
            |.:.|.||||..   :|.|:.|.|||.|||.:::|||.:.|.||||||..|||.......|:|:|
Mouse   114 PHNLTCWQSENY---LQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQ 175

  Fly   190 FYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPSGINFERSGELQ 254
            |||..||..|:.|....|.| :.|..|:||..::|:.||..|.||||||:||||..:|:.|..||
Mouse   176 FYSTQCRKMYNRPHRAPITK-QNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQ 239

  Fly   255 EWVTATDIRITLDRLNTFGDELFGDSQVLK-SYFYAISDIAVGARCKCNGHASKCVPSTGMHGER 318
            :||||||||:...||:|||||...||::.: ||:||:||:.||.||||||||::||...    :.
Mouse   240 DWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDR----DD 300

  Fly   319 TLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTGH--G 381
            :|||:|||||.||:||||.|.:.|..|:|:|:.|.|||.|||||..|.:|.|:..|:..:|.  |
Mouse   301 SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSG 365

  Fly   382 GHCLDCRENRDGPNCERCKENFYMRDDG-------YCVNCACDPVGSRSLQCN-SHGKCQCKPGV 438
            |.||:||.|..|.:|..|||.|| ||.|       .|..|.|.|||:....|| :.|:|.||.||
Mouse   366 GVCLNCRHNTAGRHCHYCKEGFY-RDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQCPCKDGV 429

  Fly   439 TGDKCDRCDNNYYQ 452
            ||..|:||...|.|
Mouse   430 TGITCNRCAKGYQQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LanB2NP_001287009.1 LamNT 61..296 CDD:214532 107/241 (44%)
EGF_Lam 298..347 CDD:238012 27/48 (56%)
Laminin_EGF 359..414 CDD:278482 27/63 (43%)
EGF_Lam 414..458 CDD:214543 20/40 (50%)
Laminin_EGF 461..511 CDD:278482
LamB 572..697 CDD:214597
TNFRSF <721..848 CDD:304602
CRD2 724..771 CDD:276900
EGF_Lam 743..791 CDD:238012
Laminin_EGF 847..897 CDD:278482
Laminin_EGF 902..953 CDD:278482
Laminin_EGF 956..1004 CDD:278482
Laminin_EGF 1004..1050 CDD:278482
V_Alix_like 1122..1443 CDD:187408
Tar 1139..1521 CDD:223910
BAR 1308..1469 CDD:299863
vATP-synt_E 1474..>1629 CDD:304907
Ntn1NP_032770.2 LamNT 46..283 CDD:214532 108/241 (45%)
EGF_Lam 284..329 CDD:238012 27/48 (56%)
Laminin_EGF 341..394 CDD:365839 26/53 (49%)
EGF_Lam 403..451 CDD:238012 20/41 (49%)
NTR_netrin-1_like 487..601 CDD:239634
Cell attachment site. /evidence=ECO:0000255 530..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.