DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and RSPH1

DIOPT Version :10

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens


Alignment Length:156 Identity:42/156 - (26%)
Similarity:66/156 - (42%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLTGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQ------VT 74
            |..|..|.| |.|.|.:. .|:|.:.:|..|.||::.|:.||:||...||  |..|:      :.
Human    38 LPNGDTYEG-SYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPD--GSRYEGEWANDLR 99

  Fly    75 HHNGRLVSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQET------KEPMDAVGPN 133
            |.:|....|:    ||:...::.....:...    ||...|....|..|      :...:.:..|
Human   100 HGHGVYYYIN----NDTYTGEWFAHQRHGQG----TYLYAETGSKYVGTWVNGQQEGTAELIHLN 156

  Fly   134 -----KFQSKDGPNPLNLGRNIFDLG 154
                 ||.:|   ||:..|:.:||:|
Human   157 HRYQGKFLNK---NPVGPGKYVFDVG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <20..>79 CDD:443680 22/65 (34%)
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 1/3 (33%)
COG4642 <15..176 CDD:443680 39/151 (26%)
MORN 1 20..43 2/4 (50%)
MORN 2 44..66 8/22 (36%)
MORN 3 67..89 11/23 (48%)
MORN 4 90..112 5/25 (20%)
MORN 5 113..135 3/25 (12%)
MORN 6 159..181 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.