DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and AT1G77660

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_177889.1 Gene:AT1G77660 / 844102 AraportID:AT1G77660 Length:421 Species:Arabidopsis thaliana


Alignment Length:147 Identity:31/147 - (21%)
Similarity:52/147 - (35%) Gaps:46/147 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSI 83
            ||.:|| ..:.|::. :|.|.:.:|..|.||:..::.||.|.....:  |..|:...|.||....
plant   272 GSSFVG-EFKFGVKHGLGSYHFRNGDKYAGEYFGDKIHGFGVYHFAN--GHYYEGAWHEGRKQGY 333

  Fly    84 ---------------DQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGPN 133
                           |..|..:.||:|                 :...||..|..:|        
plant   334 GTYRFRTGDIKSGEWDDGNLVNHLPLD-----------------SDPVRRAVQSARE-------- 373

  Fly   134 KFQSKDGPNPLNLGRNI 150
              ::|:|.|...:...:
plant   374 --RAKNGVNQRRIDEQV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 16/68 (24%)
AT1G77660NP_177889.1 PLN03185 173..>351 CDD:215619 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.