DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and AT1G21920

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_173610.1 Gene:AT1G21920 / 838794 AraportID:AT1G21920 Length:417 Species:Arabidopsis thaliana


Alignment Length:94 Identity:25/94 - (26%)
Similarity:40/94 - (42%) Gaps:19/94 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSI 83
            ||.|:|.| ..|::. :|.|.:.:|..|.||:..::.||.|..:..:  |..|:...|.||....
plant   268 GSSYLGES-RFGVKHGLGSYHFRNGDKYAGEYFGDKIHGFGVYRFAN--GHCYEGAWHEGRKQGF 329

  Fly    84 DQVNFND---------------SLPVDFE 97
            ...:|.:               |||:..|
plant   330 GAYSFRNGDAKSGEWDSGVLVTSLPLTSE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 15/53 (28%)
AT1G21920NP_173610.1 PLN03185 169..>348 CDD:215619 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.