DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and MORN1

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_079124.1 Gene:MORN1 / 79906 HGNCID:25852 Length:497 Species:Homo sapiens


Alignment Length:278 Identity:55/278 - (19%)
Similarity:90/278 - (32%) Gaps:85/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GVYIYPDGTC-YTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSIDQVNFNDSLPVDFEMK 99
            |||:||:... |.||:...|.||.|.:...|  |..|:....:|.:..              |.:
Human    28 GVYVYPNSFFRYEGEWKAGRKHGHGKLLFKD--GSYYEGAFVDGEITG--------------EGR 76

  Fly   100 DHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGPNKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFM 164
            .|:.     |:..|...:....|.:      |....:.|.|      |....::..|:....||:
Human    77 RHWA-----WSGDTFSGQFVLGEPQ------GYGVMEYKAG------GCYEGEVSHGMREGHGFL 124

  Fly   165 LD-------------------TKTFSNQSIYLGCREARRWIRE--------NCAHGPLSKRHHKQ 202
            :|                   ...|.|...|.|     .|:|:        .||.|...|     
Human   125 VDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDG-----DWVRDRRQGHGVLRCADGSTYK----- 179

  Fly   203 KLLARFAREIIRNNQENAGCSQREF---MTKIHPCKHSTSLDSFASERLHLASTTDSTTSEAQAM 264
               .::..::.......|.||...:   ....||.:.:|.:.....|.:.:|..:..:.: .|.:
Human   180 ---GQWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVN-VQLL 240

  Fly   265 GLRHEEFHGNWTRAKSES 282
                 :.||.  .|||||
Human   241 -----QDHGE--IAKSES 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 16/54 (30%)
MORN1NP_079124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
MORN 39..61 CDD:280628 9/23 (39%)
MORN 1 39..61 9/23 (39%)
COG4642 59..191 CDD:226989 26/175 (15%)
MORN 2 62..84 5/40 (13%)
MORN 3 86..108 4/33 (12%)
MORN 4 109..131 4/21 (19%)
MORN 5 132..154 2/21 (10%)
MORN 155..177 CDD:280628 7/26 (27%)
MORN 6 155..177 7/26 (27%)
MORN 7 178..200 4/29 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.