DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3306 and Jph2

DIOPT Version :9

Sequence 1:	NP_648335.1	Gene:	CG3306 / 39116	FlyBaseID:	FBgn0036016	Length:	288	Species:	Drosophila melanogaster
Sequence 2:	NP_001192005.1	Gene:	Jph2 / 59091	MGIID:	1891496	Length:	696	Species:	Mus musculus

Alignment Length:	73	Identity:	22/73 - (30%)
Similarity:	33/73 - (45%)	Gaps:	14/73 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 TGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQ-IPDSLGV-----------T 70
            :|::|.|..:. |:|: .|...|.||..|.|:|.|...||.|..| :|..:.|           :
Mouse   102 SGAKYEGTWNN-GLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSS 165

  Fly    71 YQVTHHNG 78
            .:..|.||
Mouse   166 LRSEHSNG 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3306	NP_648335.1	COG4642	<36..90	CDD:226989	17/55 (31%)
Jph2	NP_001192005.1	Bipartite nuclear localization signal. /evidence=ECO:0000269\|PubMed:30409805	345..359
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	439..664
		PHA03307	442..>643	CDD:223039
		Nuclear localization signal. /evidence=ECO:0000269\|PubMed:30409805	488..492
		PLN03185	4..>143	CDD:215619	15/41 (37%)
		MORN 1. /evidence=ECO:0000255	14..36
		MORN 2. /evidence=ECO:0000255	38..59
		MORN 3. /evidence=ECO:0000255	60..79
		MORN 4. /evidence=ECO:0000255	82..104		0/1 (0%)
		PLN03185	103..>328	CDD:215619	22/72 (31%)
		MORN 5. /evidence=ECO:0000255	106..128		8/22 (36%)
		MORN 6. /evidence=ECO:0000255	129..151		9/21 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	164..192		3/10 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	246..273
		MORN 7. /evidence=ECO:0000255	285..307
		MORN 8. /evidence=ECO:0000255	308..330
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900