DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3306 and JPH1

DIOPT Version :9

Sequence 1:	NP_648335.1	Gene:	CG3306 / 39116	FlyBaseID:	FBgn0036016	Length:	288	Species:	Drosophila melanogaster
Sequence 2:	NP_001304759.1	Gene:	JPH1 / 56704	HGNCID:	14201	Length:	661	Species:	Homo sapiens

Alignment Length:	47	Identity:	18/47 - (38%)
Similarity:	23/47 - (48%)	Gaps:	2/47 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 LLTGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQ 62
            |.|.:||.|.... |:|: .||..|.||..|.|::.....||.|..|
Human   100 LCTPARYEGTWSN-GLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQ 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3306	NP_648335.1	COG4642	<36..90	CDD:226989	11/27 (41%)
JPH1	NP_001304759.1	PLN03185	4..>143	CDD:215619	16/43 (37%)
		MORN 1	14..36
		MORN 2	38..59
		MORN 3	60..82
		PLN03185	106..>325	CDD:215619	15/41 (37%)
		MORN 4	106..128		9/22 (41%)
		MORN 5	129..151		6/17 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	228..247
		MORN 6	281..303
		MORN 7	304..326
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	433..631
		TonB	<434..>528	CDD:223880
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900