DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and jph3a

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_693582.3 Gene:jph3a / 565205 ZFINID:ZDB-GENE-110408-64 Length:887 Species:Danio rerio


Alignment Length:306 Identity:62/306 - (20%)
Similarity:90/306 - (29%) Gaps:127/306 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVS 82
            :||||.|.... |:|: .|...|.||..|.|::|:...||.|..|                    
Zfish   103 SGSRYEGTWSN-GLQDGYGSETYSDGGTYQGQWLSGLRHGYGVRQ-------------------- 146

  Fly    83 IDQVNFNDSLPVDFEMKDHYTMS---FKPWTYCTPEDRRFYQETKEPMDAVGPNKFQSKDG-PNP 143
                    |:|        |.|:   |.|  .||               ::...:....:| |.|
Zfish   147 --------SVP--------YGMAAIIFSP--MCT---------------SINSLRSDHSEGAPTP 178

  Fly   144 LNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENCAHGPLSKRHHKQKLLARF 208
            .: |..:..:....:|..||:|                        |||.. :.||.|:|  .||
Zfish   179 ED-GSGVSGVSGSPVGRSGFVL------------------------CAHSE-ADRHRKRK--GRF 215

  Fly   209 AREIIRNNQENAGCSQREFMTKIHPCKHSTSLDSFASE--------------------RLHLAST 253
            .:.|:      :|...|...:|.......:...||.||                    ......:
Zfish   216 RQSIL------SGLKLRRSESKSSLASQLSKQSSFCSEAGMSTVSSAASDINSNVSLGEAEAGGS 274

  Fly   254 TDSTTSEAQA----------MGLRHE----EFHGNWTRAKSESSVC 285
            .|:|.:|..|          .|:.|.    .|.|.|...|.....|
Zfish   275 VDATVTETYAGEWRNDMRTGWGVSHRSDGLHFEGEWFGNKRHGYGC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 11/53 (21%)
jph3aXP_693582.3 MORN 107..129 CDD:280628 8/22 (36%)
MORN 306..328 CDD:280628 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.