DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and jph2

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001082833.1 Gene:jph2 / 553333 ZFINID:ZDB-GENE-030131-9848 Length:781 Species:Danio rerio


Alignment Length:354 Identity:68/354 - (19%)
Similarity:114/354 - (32%) Gaps:113/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQ-IPDSLGV-----------T 70
            :|::|.|..:. |:|: .|...|.||..:.|:|.....||.|..| :|..:..           :
Zfish   102 SGAKYEGTWNN-GLQDGYGTETYADGGTFQGQFTGGMRHGYGVRQSVPYGMAAVVHSPLRNSLSS 165

  Fly    71 YQVTHHNGRLVS-----IDQVNFN-DSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDA 129
            .:..|.||.|:.     |...|.: ...||:..|.            ..|....|....:...||
Zfish   166 LRSEHSNGTLLQQDVPVITTTNASGQETPVNLPMP------------LGPSRGGFALTLQVDPDA 218

  Fly   130 VGP------------NKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREA 182
            |.|            .|.:..|....|:..::    ....|.....:....:.:|.:|.||..|.
Zfish   219 VKPKKSGLFRRGSFLGKLKKSDSRTSLSSQKS----KISFLRTESALSSAASDANSTISLGESEG 279

  Fly   183 R-----------------------RWIRENCAHGPLSKRHHKQKLLARFAREIIRNNQENAGC-- 222
            .                       .|..:..:...:|:|....|    :..|.:.|.:...||  
Zfish   280 EGEGHNFPPVEADIDATTTEVYMGEWKNDKRSGYGISERSSGLK----YEGEWLNNQRHGYGCTT 340

  Fly   223 ------------------SQREFM-----TKIHPCKHSTSLD------SFASERLHLASTTDSTT 258
                              |.::.|     |||.. |...||:      :.|.::..:|   :|.|
Zfish   341 FPEGGKEEGKYVNNMLVKSVKKKMIQLKGTKIKQ-KVERSLEGAQRAAAIAKQKAEIA---NSRT 401

  Fly   259 SEAQAMGLRHEEFHGNWTRAKSESSVCRI 287
            :.|::.|...|:..   ..|.:|||:.|:
Zfish   402 AHAKSKGDAAEQAA---VAANNESSIARV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 17/71 (24%)
jph2NP_001082833.1 MORN 106..128 CDD:280628 8/22 (36%)
MORN 324..346 CDD:280628 4/21 (19%)
TonB_N 605..757 CDD:292650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.