DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and morn4

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001017559.1 Gene:morn4 / 550131 ZFINID:ZDB-GENE-050417-7 Length:146 Species:Danio rerio


Alignment Length:111 Identity:29/111 - (26%)
Similarity:45/111 - (40%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSI 83
            :|..|.|...|......|...:.|||||.|.|.|..|||.|.:..||  |..|:.....|:...:
Zfish    12 SGEEYTGEWKEGRRHGKGELKFADGTCYKGHFENGLFHGSGVLVFPD--GSRYEGEFAQGKFQGV 74

  Fly    84 DQVNFNDSLPVDFEMKD-----HYTMSFKPWTYCTPEDRRFYQETK 124
            ...:..|.:..:.|.|.     |..::|...::..|.:...::..|
Zfish    75 GIFSRFDGMKFEGEFKSGRVEGHGLLTFPDGSHGAPRNEGMFENNK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 18/53 (34%)
morn4NP_001017559.1 COG4642 6..123 CDD:226989 29/111 (26%)
MORN 16..37 CDD:280628 5/20 (25%)
MORN 39..61 CDD:280628 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.