DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Morn5

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001381999.1 Gene:Morn5 / 362122 RGDID:1307739 Length:173 Species:Rattus norvegicus


Alignment Length:175 Identity:50/175 - (28%)
Similarity:72/175 - (41%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSI 83
            |||:|:|......|:....||.|..|.|.||..:..|||.||:..|.  |..:......|.:|| 
  Rat     4 TGSKYIGAYKNGRMEGNAEYILPTDTRYVGEMKDGMFHGDGTLFFPS--GSRFDAIWEKGLVVS- 65

  Fly    84 DQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGPNKFQSKDGPNPLNLGR 148
            .:..|.|.|    :.:|      |.|.||...|||||.|....:...|.::..:.|.|..:..| 
  Rat    66 GKYTFKDGL----QYED------KHWHYCDSYDRRFYTEICYGLKPSGISQLTNMDPPRKIPPG- 119

  Fly   149 NIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENCAHG 193
             .:|.|.|.......::  |.:.|:.:.....:...||...|..|
  Rat   120 -YYDCGDGFYNPMTRVI--KDYRNRFLRNADDDEHEWIIRTCRKG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 18/53 (34%)
Morn5NP_001381999.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1312559at2759
OrthoFinder 1 1.000 - - FOG0007787
OrthoInspector 1 1.000 - - otm45606
orthoMCL 1 0.900 - - OOG6_105927
Panther 1 1.100 - - LDO PTHR46437
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.