DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Rsph1

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_609609.1 Gene:Rsph1 / 34712 FlyBaseID:FBgn0032478 Length:344 Species:Drosophila melanogaster


Alignment Length:169 Identity:42/169 - (24%)
Similarity:66/169 - (39%) Gaps:26/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDILLTGSRYVGP---SDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTH 75
            |.:...||||.|.   ....|   .|::|||||:.|.|.:..|..||||..:..:  |..|....
  Fly    65 VYVFKDGSRYYGQYRCGKRCG---RGIFIYPDGSVYEGNWRKNLKHGKGRYKYVN--GDNYSGDW 124

  Fly    76 HNGRLVSIDQVNFN---DSLPVDFEMKDHYTMSFK--PW-TYCTPEDRRFYQETKEPMDAVGPNK 134
            ..|:...:...:||   |...:...||..:..:.:  |: .|...||:...      :..:..|.
  Fly   125 FKGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTI------LHGIWDNL 183

  Fly   135 FQSKDGPNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQ 173
            :.|  ||...:.......||:.|..:    .:.|..||:
  Fly   184 YPS--GPAVFSFNNRYLLLGYFLPAS----YNMKAISNE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 18/56 (32%)
Rsph1NP_609609.1 MORN 51..73 CDD:280628 2/7 (29%)
MORN 72..93 CDD:197832 8/23 (35%)
MORN 95..116 CDD:197832 7/20 (35%)
MORN 118..137 CDD:197832 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.