DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and jp

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001188757.1 Gene:jp / 34274 FlyBaseID:FBgn0032129 Length:1054 Species:Drosophila melanogaster


Alignment Length:298 Identity:62/298 - (20%)
Similarity:95/298 - (31%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGP---SDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSL--GVTYQVTHHNG 78
            ||.::.|.   :...|.:..|.||:|.|:.|.|::.|.|.||.|..||...:  | .:....|.|
  Fly    76 TGPKHQGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRG-EWSKDGHKG 139

  Fly    79 RLVSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYC-TPEDRRFYQ-------------ETKEPMDA 129
            |      ....:|.....:.:..:...::..:.| |..|...||             .|..|...
  Fly   140 R------YGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGL 198

  Fly   130 VGPNKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENCAHGP 194
            ...::.:        ||..::..|..|..||...|::..........|..:..:..:|.|.....
  Fly   199 ASHHRRK--------NLHASLSSLRSGENGNAAKMVEKAEEIRGGFVLTAKSDKLPVRRNSLTDK 255

  Fly   195 LSKRHHKQKLLARFAREI-------------IRNNQENA-----GCSQREFMTKIHPCKHSTSLD 241
            ..|:.....|..|..|..             ||:...:|     |..|....||   ..|:.|..
  Fly   256 TGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTK---SNHTESNA 317

  Fly   242 SFASERLHLASTTDSTTSEAQAMGLRHEEFHGNWTRAK 279
            ||..|...|..|...|             :.|.|.:.|
  Fly   318 SFTMEDEQLDPTVVET-------------YMGEWKKDK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 18/55 (33%)
jpNP_001188757.1 PLN03185 46..>192 CDD:215619 28/122 (23%)
PLN03185 333..>388 CDD:215619 4/23 (17%)
MORN 357..379 CDD:308220
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.