DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Als2cl

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006244073.1 Gene:Als2cl / 316017 RGDID:1305208 Length:952 Species:Rattus norvegicus


Alignment Length:319 Identity:67/319 - (21%)
Similarity:107/319 - (33%) Gaps:106/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQI-PDSL---GVTYQVTHHNGRL 80
            |.||:|..........|:.:...|.||.|.|..::..|.|.:.. .|||   ..|.::|     |
  Rat   480 GERYIGMWQADQRHGPGIVVTQAGVCYQGTFQGDKMAGPGILLCEDDSLYEGTFTRELT-----L 539

  Fly    81 VSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDAVG-PNKFQSKDGPNPL 144
            :...:|.|    |..|.::.         ::|:..|:..|  |:..:|... |        |||.
  Rat   540 LGKGKVTF----PNGFTLEG---------SFCSGTDKGLY--TQGVLDTTALP--------PNPS 581

  Fly   145 NLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIY--------LGC----------------REARRW 185
            :..:.  .||.|     .|.::::.   |.:|        |||                ||.|:.
  Rat   582 STRKR--QLGLG-----AFPVESRW---QGVYSPFRDFLRLGCPGELQEALLGFHVQSSRELRKS 636

  Fly   186 IRENCAHGPLSK--------------RHHKQKLLARFAREIIRNNQENAGCSQREFM-------T 229
            ....|......|              :|.|.|.|.::.|:.:.|::...|...:..|       :
  Rat   637 QEYLCCERSHPKDCVGSMEDILKELLQHRKPKALQQYLRKALSNSRHPLGKLLQTLMLTFQATYS 701

  Fly   230 KIHPCKHSTSLDSFASER---------------LHLASTTDSTTSEAQAMGLRHEEFHG 273
            .|...||   |.:.|.|.               |.:|......|.|.::|..|..:.||
  Rat   702 GIGANKH---LQAMAQEEVKQHARELWAAYRGLLKVALLRQGQTLEEESMETRDLQVHG 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 16/57 (28%)
Als2clXP_006244073.1 PH-like 223..321 CDD:418428
PLN03185 357..>550 CDD:215619 21/78 (27%)
VPS9 835..937 CDD:388595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.