DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Jph3

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001100907.1 Gene:Jph3 / 307916 RGDID:1308416 Length:749 Species:Rattus norvegicus


Alignment Length:340 Identity:64/340 - (18%)
Similarity:100/340 - (29%) Gaps:153/340 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSR----YVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGR 79
            ||.:    |.| |...|.:.:|||.:|.|..|.|.:...:.||.|              ....|:
  Rat    31 TGPKGQGEYTG-SWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIG--------------LESKGK 80

  Fly    80 LVSIDQVNFNDSLPVDFEMKDHYTMSFKPWTY----CTPEDRRFYQETKEPMDAVGPNKFQSKDG 140
            .|                .|..:|..|| ..|    ||....::        :....|..|.   
  Rat    81 WV----------------YKGEWTHGFK-GRYGVRECTGNGAKY--------EGTWSNGLQD--- 117

  Fly   141 PNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRW---------IRENCAHG--- 193
                         |:|          |:|:|:...|.|     :|         :|::..:|   
  Rat   118 -------------GYG----------TETYSDGGTYQG-----QWVGGMRQGYGVRQSVPYGMAA 154

  Fly   194 ----PLS------KRHHKQ-----------------------KLLARFAREIIRNNQENAGCSQR 225
                ||.      :..|..                       .|:|....||:::.::  |..:|
  Rat   155 VIRSPLRTSINSLRSEHTNGAALHPDASPAVAGSPAVSRGGFVLVAHSDSEILKSKKK--GLFRR 217

  Fly   226 EFMTKIHPCKHSTSLDSFASERLHLA--------STTDSTTS---------EAQAM--------- 264
            ..::.: ..:.|.|..|.||:|...:        ||..||.|         ||:|.         
  Rat   218 SLLSGL-KLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDID 281

  Fly   265 GLRHEEFHGNWTRAK 279
            ....|.:.|.|...|
  Rat   282 ATTTETYVGEWKNDK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 12/53 (23%)
Jph3NP_001100907.1 MORN 15..35 CDD:280628 2/3 (67%)
MORN 107..129 CDD:280628 7/55 (13%)
MORN 311..333 CDD:280628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.