DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Morn1

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_038965637.1 Gene:Morn1 / 298676 RGDID:1359433 Length:552 Species:Rattus norvegicus


Alignment Length:190 Identity:44/190 - (23%)
Similarity:59/190 - (31%) Gaps:66/190 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GVYIYPDGTC-YTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSIDQVNFNDSLPVDFEMK 99
            |||:||:... |.||:...:.||.|.:...|  |..|:....||.:..              |..
  Rat    28 GVYVYPNSFFRYEGEWKGGKKHGHGKLLFKD--GSYYEGEFVNGEITG--------------EGY 76

  Fly   100 DHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGPNKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFM 164
            .|:..|..  ||    ..:|.  ..||.   |....:.|.|      |....:|..||...:||:
  Rat    77 QHWAWSGN--TY----SGQFV--LGEPQ---GHGIMKYKAG------GHYEGELSQGLREGQGFL 124

  Fly   165 LD-------------------TKTFSNQSIYLGCREARRWIREN--------CAHGPLSK 197
            .|                   ...|.|...|.|     .|:|:.        ||.|...|
  Rat   125 EDQDGQVYQGSFHDNKRHGRGQMVFKNGDKYEG-----DWVRDQRQGHGVLFCADGSTYK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 16/54 (30%)
Morn1XP_038965637.1 PLN03185 58..>208 CDD:215619 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.