DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3306 and Jph2

DIOPT Version :9

Sequence 1:	NP_648335.1	Gene:	CG3306 / 39116	FlyBaseID:	FBgn0036016	Length:	288	Species:	Drosophila melanogaster
Sequence 2:	NP_001033063.1	Gene:	Jph2 / 296345	RGDID:	1305196	Length:	692	Species:	Rattus norvegicus

Alignment Length:	92	Identity:	26/92 - (28%)
Similarity:	41/92 - (44%)	Gaps:	4/92 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 TGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQ-IPDSLGVTYQVTHHNGRLV 81
            :|::|.|..:. |:|: .|...|.||..|.|:|.|...||.|..| :|..:.|..:...... |.
  Rat   102 SGAKYEGTWNN-GLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTS-LS 164

  Fly    82 SIDQVNFNDSLPVDFEMKDHYTMSFKP 108
            |:...:.|.::..|....|..|:...|
  Rat   165 SLRSEHSNGTVAPDSPAADGPTLPLPP 191

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3306	NP_648335.1	COG4642	<36..90	CDD:226989	16/54 (30%)
Jph2	NP_001033063.1	MORN 1. /evidence=ECO:0000255	14..36
		MORN 2. /evidence=ECO:0000255	38..59
		MORN 3. /evidence=ECO:0000255	60..79
		MORN 4. /evidence=ECO:0000255	82..104		0/1 (0%)
		MORN	106..128	CDD:280628	8/22 (36%)
		MORN 5. /evidence=ECO:0000255	106..128		8/22 (36%)
		MORN 6. /evidence=ECO:0000255	129..151		9/21 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	164..190		5/25 (20%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	246..273
		MORN 7. /evidence=ECO:0000255	285..307
		MORN	307..327	CDD:197832
		MORN 8. /evidence=ECO:0000255	308..330
		Bipartite nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	345..359
		Vinculin	<413..>497	CDD:279395
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	439..661
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q9ET78	488..492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900