DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Rsph10b

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006248920.1 Gene:Rsph10b / 288478 RGDID:1311893 Length:906 Species:Rattus norvegicus


Alignment Length:235 Identity:47/235 - (20%)
Similarity:78/235 - (33%) Gaps:83/235 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSIDQ 85
            :.|:|..........|.:.|..|..|.||:::|:..|:|            ::|..|||:  .:.
  Rat   312 NEYIGAFVNGFRHGQGKFYYASGAMYEGEWVSNKKQGRG------------RITFKNGRV--YEG 362

  Fly    86 VNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRR--FYQETKEPMDAVG--------PNKFQSKDG 140
            :..||.:...||.:..|:.|.         |||  ..|.:::   |.|        |...:..||
  Rat   363 LFSNDHIAQFFEAEMDYSYSL---------DRRSDISQRSRQ---ARGSSVSADREPETLRKLDG 415

  Fly   141 PNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENCAHGPLSKRHHKQKLL 205
            ....::..:..:|...||      ||.....:|                          .::|..
  Rat   416 SESRSVLGSSIELDLNLL------LDMYPEESQ--------------------------EEEKKQ 448

  Fly   206 ARFAREIIRNNQE---------NAGC----SQREFMTKIH 232
            ..:|  ::||..|         ..||    .....|||:|
  Rat   449 VEYA--VLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLH 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 13/53 (25%)
Rsph10bXP_006248920.1 PLN03185 86..>200 CDD:215619
PLN03185 158..>421 CDD:215619 30/134 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.