DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and MORN5

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_940871.2 Gene:MORN5 / 254956 HGNCID:17841 Length:161 Species:Homo sapiens


Alignment Length:175 Identity:51/175 - (29%)
Similarity:71/175 - (40%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRLVSI 83
            |||:|:|...:..|:....||.|..|.|.||..:..|||:||:..|.  |..|.....||..:. 
Human     4 TGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPS--GSQYDAIWENGLAIK- 65

  Fly    84 DQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGPNKFQSKDGPNPLNLGR 148
            ....|:|.|        ||  ..|.|.||...|||||.|....:...|..:..:.|.|..:..| 
Human    66 GTYTFSDGL--------HY--DEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKG- 119

  Fly   149 NIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENCAHG 193
             .:|.|.|.......::  |.:.|:.:.....:...||...|..|
Human   120 -YYDCGDGFYNPVTRVV--KDYRNRFLRNADDDEHEWITRTCRKG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 18/53 (34%)
MORN5NP_940871.2 COG4642 5..>76 CDD:332236 25/81 (31%)
MORN 1 8..30 6/21 (29%)
MORN 2 31..53 10/23 (43%)
MORN 3 54..75 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5329
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1312559at2759
OrthoFinder 1 1.000 - - FOG0007787
OrthoInspector 1 1.000 - - otm41489
orthoMCL 1 0.900 - - OOG6_105927
Panther 1 1.100 - - LDO PTHR46437
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.