DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and Rsph1

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_079566.1 Gene:Rsph1 / 22092 MGIID:1194909 Length:301 Species:Mus musculus


Alignment Length:173 Identity:43/173 - (24%)
Similarity:60/173 - (34%) Gaps:66/173 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLTGSRYVGPSDELGMQE-MGVYIYPDGTCYTGEFLNNRFHGKGTIQIPD--------------S 66
            |..|..|.| |.|.|.:. .|.|.:.:|..|||:::.|:.||:||...||              .
Mouse    38 LPNGDTYEG-SYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHG 101

  Fly    67 LGVTYQVTHHNGRLVSIDQVNFNDSLPVDFEMKDHYTMSFKPW---------TYCTPEDRRFYQE 122
            .||.|.|.:                        |.||   ..|         ||...|....|..
Mouse   102 QGVYYYVNN------------------------DTYT---GEWFNHQRHGQGTYLYAETGSKYVG 139

  Fly   123 T------KEPMDAVGPN-----KFQSKDGPNPLNLGRNIFDLG 154
            |      :...:.:..|     ||.:|   ||:..|:.:||:|
Mouse   140 TWVHGQQEGAAELIHLNHRYQGKFMNK---NPVGPGKYVFDIG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 17/67 (25%)
Rsph1NP_079566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/2 (50%)
MORN 1 20..43 2/4 (50%)
COG4642 37..172 CDD:226989 39/164 (24%)
MORN 42..63 CDD:197832 7/21 (33%)
MORN 2 44..66 8/22 (36%)
MORN 67..89 CDD:280628 10/21 (48%)
MORN 3 67..89 10/21 (48%)
MORN 88..109 CDD:197832 3/20 (15%)
MORN 4 90..112 4/45 (9%)
MORN 111..131 CDD:197832 6/22 (27%)
MORN 5 113..135 6/24 (25%)
MORN 6 159..181 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.