DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3306 and als2b

DIOPT Version :9

Sequence 1:	NP_648335.1	Gene:	CG3306 / 39116	FlyBaseID:	FBgn0036016	Length:	288	Species:	Drosophila melanogaster
Sequence 2:	XP_009300450.1	Gene:	als2b / 100318899	ZFINID:	ZDB-GENE-080929-1	Length:	1706	Species:	Danio rerio

Alignment Length:	198	Identity:	44/198 - (22%)
Similarity:	62/198 - (31%)	Gaps:	76/198 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 SITQ-VDILLTGSRYVGPSDELGMQE---------MGVYIYPDGTC----YTGEFLNNRFHGKGT 60
            ||.| |:..|:|..:.|.....||.:         .....|.|...    |.|.:::.:.||:|.
Zfish  1054 SINQAVEQALSGLGHDGIPPSTGMTQRADPPISRTASYTFYKDSRLKDAKYDGRWVSGKPHGRGV 1118

  Fly    61 IQIPDSLGVTYQVTHHNGRLVSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKE 125
            ::.||  |..|..|..||         |.|..       ..|.:|.|....|.     .||.
Zfish  1119 VKWPD--GRMYTGTFKNG---------FEDGF-------GDYVVSNKTLNSCD-----HYQG--- 1157

  Fly   126 PMDAVGPNKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENC 190
                      |.|||...          |||          |..:::..:|.|.      .::|.
Zfish  1158 ----------QWKDGKMH----------GFG----------TFRYASGEVYEGS------FQDNM 1186

  Fly   191 AHG 193
            .||
Zfish  1187 RHG 1189

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3306	NP_648335.1	COG4642	<36..90	CDD:226989	15/57 (26%)
als2b	XP_009300450.1	RCC1_2	88..117	CDD:290274
		RCC1	104..160	CDD:278826
		RCC1	165..211	CDD:278826
		RCC1	567..614	CDD:278826
		RCC1	619..665	CDD:278826
		PH_alsin	952..1065	CDD:241423	5/10 (50%)
		COG4642	1085..1290	CDD:226989	35/167 (21%)
		MORN	1104..1124	CDD:280628	7/21 (33%)
		MORN	1153..1173	CDD:197832	10/57 (18%)
		VPS9	1603..1702	CDD:280383
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900