Sequence 1: | NP_648335.1 | Gene: | CG3306 / 39116 | FlyBaseID: | FBgn0036016 | Length: | 288 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009300450.1 | Gene: | als2b / 100318899 | ZFINID: | ZDB-GENE-080929-1 | Length: | 1706 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 44/198 - (22%) |
---|---|---|---|
Similarity: | 62/198 - (31%) | Gaps: | 76/198 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SITQ-VDILLTGSRYVGPSDELGMQE---------MGVYIYPDGTC----YTGEFLNNRFHGKGT 60
Fly 61 IQIPDSLGVTYQVTHHNGRLVSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKE 125
Fly 126 PMDAVGPNKFQSKDGPNPLNLGRNIFDLGFGLLGNRGFMLDTKTFSNQSIYLGCREARRWIRENC 190
Fly 191 AHG 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3306 | NP_648335.1 | COG4642 | <36..90 | CDD:226989 | 15/57 (26%) |
als2b | XP_009300450.1 | RCC1_2 | 88..117 | CDD:290274 | |
RCC1 | 104..160 | CDD:278826 | |||
RCC1 | 165..211 | CDD:278826 | |||
RCC1 | 567..614 | CDD:278826 | |||
RCC1 | 619..665 | CDD:278826 | |||
PH_alsin | 952..1065 | CDD:241423 | 5/10 (50%) | ||
COG4642 | 1085..1290 | CDD:226989 | 35/167 (21%) | ||
MORN | 1104..1124 | CDD:280628 | 7/21 (33%) | ||
MORN | 1153..1173 | CDD:197832 | 10/57 (18%) | ||
VPS9 | 1603..1702 | CDD:280383 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |