DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3306 and rsph1

DIOPT Version :9

Sequence 1:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_009302854.1 Gene:rsph1 / 100003444 ZFINID:ZDB-GENE-041008-22 Length:232 Species:Danio rerio


Alignment Length:145 Identity:35/145 - (24%)
Similarity:57/145 - (39%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILLTGSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHHNGRL 80
            :|..|..|.|..:.......|.|.:.:|..||||:..|..||:||...||  |..|:.|..:.:.
Zfish    36 VLPNGDTYQGAYENGKRSSQGTYKFKNGARYTGEWYMNLKHGEGTFYYPD--GSKYEGTWVDDQR 98

  Fly    81 VSIDQVNFNDSLPVDFEMKDHYTMSFKPWTYCTPEDRRFYQETKEPMDAVGP-----NKFQSK-D 139
            ..:....:.:....|.|...|.......:||.....:.........|::.|.     :::|.. .
Zfish    99 QGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTWIMGKMESAGELIYLNHRYQGNFI 163

  Fly   140 GPNPLNLGRNIFDLG 154
            ..||...|:.:||:|
Zfish   164 NNNPSGPGKYVFDIG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 17/53 (32%)
rsph1XP_009302854.1 COG4642 19..>143 CDD:332236 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.