DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Prss22

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:284 Identity:64/284 - (22%)
Similarity:121/284 - (42%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGSAKKDSEDPD-------HIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTII 60
            :|::.:.||..|..||......||       :.|..|..:.:.|.|::|.:....|: .|:|:::
Mouse    75 ILILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSH-HCAGSLL 138

  Fly    61 GDTWILTSAQCLTGS----SGVTIYFGATRLS----------------QAQFTVTVGTSEYVTGN 105
            .:.|::|:|.|...:    |..::..||.:|.                ..:::...||      :
Mouse   139 TNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGT------H 197

  Fly   106 QHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGL----TDALQCVDL 165
            ..:||||:.. :.||.|:..:.||....|.....:.|  :.|||  :..:|:    ...||.:.:
Mouse   198 ADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW--IAGWG--SIQDGVPLPHPQTLQKLKV 258

  Fly   166 QIMSNNECIAFY----GSTTVSDQILCTRTPSG-RSTCFGDAGSPLITKQDS--TVVGISAFVAS 223
            .|:.:..|.:.|    |...:::.:||.....| |..|.||:|.||:.:.|.  .:.||.::  .
Mouse   259 PIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISW--G 321

  Fly   224 NGCT-LGLPAGFARITSALDWIHQ 246
            .||. ...|..:..:.:...|:.:
Mouse   322 EGCAERNRPGVYTSLLAHRSWVQR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 56/249 (22%)
Tryp_SPc 29..244 CDD:214473 55/247 (22%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 56/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.