DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and cela1.1

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:276 Identity:67/276 - (24%)
Similarity:120/276 - (43%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGSAK----KDSEDPDHIITNGSPAYEGQAPYVVGMAF---GQSNIWCSGTII 60
            :|.:.|...|.|.|..:    :|....:.:| .|..|.....|:.:.:.:   |:.:.:|.||:|
Zfish     1 MLRILLLSVLAAIGLTEPRYLEDLAIEERVI-GGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLI 64

  Fly    61 GDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVT-----------------GNQHL 108
            ...|::.:|.|:.     |....:..|.....|...|..:|::                 ||. :
Zfish    65 RPGWVMVAAHCVD-----TSRIWSVALGDHDTTTHEGPEQYISVKGVFIHPNWNPNIVANGND-I 123

  Fly   109 ALVRVP-RVGFSNRVNRVALPSLRNRSQRYENWWANVC---GWGVTTFSNGLTDALQCVDLQIMS 169
            ||:::. ....|:.|....|||......     :.:.|   |||.|.....|:..|:...:.::.
Zfish   124 ALLQLSINATLSSYVQVATLPSYGEILP-----YGHTCYITGWGRTQTGGSLSAQLKQAYMPVVD 183

  Fly   170 NNECIA--FYGSTTVSDQILCTRTPSGRSTCFGDAGSPL--ITKQDSTVVGISAFVASNGC-TLG 229
            :..|..  ::|| ||.|:::|....:..|.|.||:||||  :...:..|.|:::||||:|| |..
Zfish   184 HETCSQSDWWGS-TVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYK 247

  Fly   230 LPAGFARITSALDWIH 245
            .|..|.|::..:.|::
Zfish   248 KPTVFTRVSYHVSWLN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/246 (25%)
Tryp_SPc 29..244 CDD:214473 60/243 (25%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 60/244 (25%)
Tryp_SPc 30..265 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.