DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and ctrl

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:245 Identity:62/245 - (25%)
Similarity:104/245 - (42%) Gaps:47/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGA-TRLSQAQF 92
            |.||..|..|..|:.|.:.......:|.|::|...|::|:|.|...:....:..|. .|.|.|:.
Zfish    32 IVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQYWVVTAAHCRVQAGYHYVILGEHDRGSSAES 96

  Fly    93 TVTVGTSEYVT----GNQHLALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVC-------- 145
            ......::.:|    .:|:          |:|.:..:.|.|....:.|.    :.||        
Zfish    97 VQVKSIAKAITHPYYNSQN----------FNNDITLLKLSSPAQLTSRI----SPVCLAASSTSI 147

  Fly   146 ---------GWGVTTFSNGLTDA---LQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTC 198
                     |||.|    |.|.:   ||...|.::|..:|..::|...::|.::|... ||.|:|
Zfish   148 PSGTRCVTTGWGKT----GSTSSPRILQQTALPLLSPAQCKQYWGQNRITDAMICAGA-SGVSSC 207

  Fly   199 FGDAGSPLITKQDST--VVGISAFVASNGCTLGLPAGFARITSALDWIHQ 246
            .||:|.||:.:....  .|||.::..|: |.:..||.:||::....||.|
Zfish   208 QGDSGGPLVCESSGAWYQVGIVSWGTSD-CNVRTPAVYARVSYLRQWIDQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/243 (25%)
Tryp_SPc 29..244 CDD:214473 59/241 (24%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 59/241 (24%)
Tryp_SPc 32..257 CDD:238113 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.