DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CTRB2

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:243 Identity:68/243 - (27%)
Similarity:111/243 - (45%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT 93
            |.||..|..|..|:.|.:.......:|.|::|.:.|::|:|.|...:|.|.:   |....|    
Human    34 IVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVV---AGEFDQ---- 91

  Fly    94 VTVGTSE------------------YVTGNQHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYEN 139
               |:.|                  .:|.|..:.|:::.. ..||..|:.|.|||..:....   
Human    92 ---GSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPA--- 150

  Fly   140 WWANVC---GWGVTTF-SNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFG 200
              ..:|   |||.|.: :|...|.||...|.::||.||...:| ..::|.::|... ||.|:|.|
Human   151 --GTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWG-RRITDVMICAGA-SGVSSCMG 211

  Fly   201 DAGSPLITKQDS--TVVGISAFVASNGCTLGLPAGFARITSALDWIHQ 246
            |:|.||:.::|.  |:|||.:: .|..|:...||.:||:...:.|:.:
Human   212 DSGGPLVCQKDGAWTLVGIVSW-GSRTCSTTTPAVYARVAKLIPWVQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 68/241 (28%)
Tryp_SPc 29..244 CDD:214473 67/239 (28%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 67/239 (28%)
Tryp_SPc 34..259 CDD:238113 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.