DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG9737

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:103/265 - (38%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITN----GSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQ 89
            :||    |..|...:.|::..:.:..::..|||.:|.|..|||:|.|:.| .||....|...:..
  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQG-EGVRDRQGLKHVRL 209

  Fly    90 AQFTVTVGTS--------------------------EYVTGNQH----LALVRVPR-VGFSNRVN 123
            .:|.|.....                          ||...:.:    :|::|:.. |.|::.|.
  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274

  Fly   124 RVALPSLRNRSQRYENWWANVCGWGVT-TFSNGLTDALQCVDLQI----MSNNEC---IAFYGST 180
            .:.||:........|....:|.|||.| .|:....:....:.|::    :||..|   :..:|..
  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR 339

  Fly   181 TVSDQILCTRTPSGRSTCFGDAGSPLI--TKQDSTVVGISAFVASNGCT----LGLPAGFARITS 239
            ....|| |......:.||.||:|.||:  .:|.|..|...  |.|.|.|    .|.||.:..:..
  Fly   340 LGPKQI-CAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYG--VVSYGFTQCGMAGKPAVYTNVAE 401

  Fly   240 ALDWI 244
            ..|||
  Fly   402 YTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/265 (25%)
Tryp_SPc 29..244 CDD:214473 63/263 (24%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 61/260 (23%)
Tryp_SPc 150..409 CDD:238113 63/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.